SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020272 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000020272
Domain Number - Region: 24-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0002
Family G proteins 0.0087
Further Details:      
 
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily Globin-like 0.0665
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020272   Gene: ENSMMUG00000015456   Transcript: ENSMMUT00000021673
Sequence length 315
Comment pep:known_by_projection chromosome:MMUL_1:7:45772066:45832393:-1 gene:ENSMMUG00000015456 transcript:ENSMMUT00000021673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAEAWLPEVMILVCDRVSED
GVNRQKAQEWCIRHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
NQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAADRTESLSDHRSGASNTTDAQVDSIVDP
MLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
Download sequence
Identical sequences F6QB47 Q4R981
9544.ENSMMUP00000020272 ENSMMUP00000020272 NP_001271008.1.63531 ENSMMUP00000020272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]