SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020335 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000020335
Domain Number - Region: 143-284
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000455
Family Penicillin V acylase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020335   Gene: ENSMMUG00000015497   Transcript: ENSMMUT00000021738
Sequence length 395
Comment pep:known chromosome:MMUL_1:8:17949617:17979818:-1 gene:ENSMMUG00000015497 transcript:ENSMMUT00000021738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGRSRLSLVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGPAPWYTINLDLPPYK
RWHELMADKAPMLKVIVNSLKNMVNTFVPSGKVMQIVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISYNIFYEFFTLCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
ELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSVNGGYLGILEWI
LGKKDAMWIGFLTRTVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKNPFFLDDRRTPAKMCLNRTTQENISFENMYDVLST
KPVLNKLTVFTTLIDVTKDQFETYMRDCPDPCIGW
Download sequence
Identical sequences F6S5F3
XP_001098342.1.72884 ENSMMUP00000020335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]