SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020527 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020527
Domain Number 1 Region: 59-94,220-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.18e-60
Family Nuclear receptor ligand-binding domain 0.00000024
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.09e-24
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020527   Gene: ENSMMUG00000014111   Transcript: ENSMMUT00000021947
Sequence length 461
Comment pep:known_by_projection chromosome:MMUL_1:15:11247551:11273964:1 gene:ENSMMUG00000014111 transcript:ENSMMUT00000021947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHAPEPKGLAAGPPTGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHTLVKEAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences A0A096P0M0 A0A0D9RM81 A0A2K5LZ53 A0A2K5YBP6 A0A2K6CW08
9544.ENSMMUP00000020527 ENSMMUP00000020527 ENSMMUP00000018545 XP_008004468.1.81039 XP_008004469.1.81039 XP_008004472.1.81039 XP_008004473.1.81039 XP_008004474.1.81039 XP_011709625.1.29376 XP_011709626.1.29376 XP_011709627.1.29376 XP_011709629.1.29376 XP_011709630.1.29376 XP_011844063.1.47321 XP_011894590.1.92194 XP_011894591.1.92194 XP_011894592.1.92194 XP_011894593.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]