SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020646 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020646
Domain Number 1 Region: 1126-1345
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-85
Family Fibrinogen C-terminal domain-like 0.000000856
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 4.11e-24
Family Fibronectin type III 0.0000096
Further Details:      
 
Domain Number 3 Region: 955-1123
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 778-937
Classification Level Classification E-value
Superfamily Fibronectin type III 5.53e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000107
Family Fibronectin type III 0.00000385
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020646
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0072
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020646   Gene: ENSMMUG00000015723   Transcript: ENSMMUT00000022070
Sequence length 1358
Comment pep:known chromosome:MMUL_1:1:204922679:205006500:-1 gene:ENSMMUG00000015723 transcript:ENSMMUT00000022070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMLKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQDVSAEDETVAEYTGQTSDHESQVTFTHRINL
PKKACPCASSAQMLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCICEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPKGIGPTTRTTLTDLVPGT
EYGVGISAIMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMTEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLYPATEYEISLNSVRGREESERICTLVHTAMDNPVDLT
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTAWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDNRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYSHRLMAGRKRQSLQF
Download sequence
Identical sequences A0A2K5TRP8 F6SEB7
NP_001247930.1.72884 XP_005540114.1.63531 XP_014978794.1.72884 XP_015301393.1.63531 ENSMMUP00000020646 9544.ENSMMUP00000020646 ENSMMUP00000020646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]