SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020716 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020716
Domain Number 1 Region: 524-736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-35
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 2 Region: 343-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.24e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 3-109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-17
Family Laminin G-like module 0.0074
Further Details:      
 
Domain Number 4 Region: 135-193
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000398
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 106-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020716   Gene: ENSMMUG00000015772   Transcript: ENSMMUT00000022143
Sequence length 882
Comment pep:known chromosome:MMUL_1:3:184602785:185713547:1 gene:ENSMMUG00000015772 transcript:ENSMMUT00000022143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGLNDGQWHEVRFLAKENFAILTIDGDEASAVRTNSPLQVKTGEKYFFGGFLNQMNNSS
HSVLQPSFQGCMQLIQVDDQLVNLYEVAQRKPGSFANVSIDMCAIIDRCVPNHCEHGGKC
SQTWDSFRCTCDETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDGSGPLGPLKVYC
NMTEDKVWTIVSHDLQMQTNVVAYNPEKYSVTQLVYSASMDQISAITDSAEYCEQYVSYF
CKMSRLLNTPDGSPYTWWVGKANEKHYYWGGSGPGIQKCACGIERNCTDPKYYCNCDADY
KQWRKDAGFLSYKDHLPVSQVVVGDTDRQGSEAKLSVGPLRCQGDRNYWNAASFPNPSSY
LHFSTFQGETSADISFYFKTLTPWGVFLENMGKEDFIKLELKSATEVSFSFDVGNGPVEI
IVRSPTPLNDDQWHRVTAERNVKQASLQVDRLPQQIRKAPTEGHTRLELYSQLFVGGAGG
QQGFLGCIRSLRMNGVTLDLEERAKVTSGFISGCSGHCTSYGTNCENGGKCLERYHGYSC
DCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQAPAINARDSGSRVENSPDQQNSHPDLAQE
EIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMAN
GQPHSVNITRHEKTIILKLDHYPSVSYHLPSSSDTLFNSPKSLFLGKVIETGKIDQEIHK
YNTPGFTGCLSRVQFNQIAPLKAALRQTNASAHVHIQGELVESNCGASPLTLSPMSSATD
PWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRH
KGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI
Download sequence
Identical sequences G7MN84
9544.ENSMMUP00000020716 ENSMMUP00000020716 ENSMMUP00000020716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]