SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020783 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020783
Domain Number 1 Region: 218-283
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 284-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020783   Gene: ENSMMUG00000015814   Transcript: ENSMMUT00000022213
Sequence length 636
Comment pep:known_by_projection chromosome:MMUL_1:X:146023644:146059870:1 gene:ENSMMUG00000015814 transcript:ENSMMUT00000022213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENKFVWYPVSFVSFHILHFELLLFFFHD
NKHNALLLVYSRANEKEPCCWWLAKVRMIKGEISILKXAACDATYNEIVTIERLRSVNPN
KPATKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSISEVTS
KRAHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHG
ANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIG
KNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDI
KENSTHFSQPNSTKVQRVLVASSVVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLD
YHLNYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKSYVTDDGQGMGRGSRPYRN
RGHGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERENFLRRGDGRRHSMVG
LNRGCGNKELPNILVGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDCNNERSVHTKTLQ
NTSSEGNRLRTGKDRNQKKEKPDTVDGQQPLVNGVP
Download sequence
Identical sequences ENSMMUP00000020783 9544.ENSMMUP00000020783 ENSMMUP00000020783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]