SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020809 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020809
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.75e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020809
Domain Number - Region: 320-347
Classification Level Classification E-value
Superfamily E set domains 0.00476
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020809   Gene: ENSMMUG00000015828   Transcript: ENSMMUT00000022241
Sequence length 382
Comment pep:known chromosome:MMUL_1:5:21146920:21215001:1 gene:ENSMMUG00000015828 transcript:ENSMMUT00000022241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQVWREYALCRPRHF
CIPSRLEMGPATSPGSSNFGPK
Download sequence
Identical sequences A0A1D5RFV9 A0A2K6CZ79
ENSMMUP00000020809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]