SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020812 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020812
Domain Number 1 Region: 101-258
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 3.53e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 259-369
Classification Level Classification E-value
Superfamily E set domains 7.28e-38
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1-103
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.17e-35
Family DNA-binding protein LAG-1 (CSL) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020812   Gene: ENSMMUG00000015828   Transcript: ENSMMUT00000022244
Sequence length 423
Comment pep:known chromosome:MMUL_1:5:21172569:21215029:1 gene:ENSMMUG00000015828 transcript:ENSMMUT00000022244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDK
RKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRS
QTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVT
GMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPK
EPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTG
QNFTPNLRVWFGDVEAETMYRCGESMLCVVPDLHSVKVGDGSQPVQVPVTLVRNDGIIYS
TSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTAT
VVS
Download sequence
Identical sequences ENSMMUP00000020812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]