SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020816 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020816
Domain Number 1 Region: 157-314
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.58e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 11-159
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 315-427
Classification Level Classification E-value
Superfamily E set domains 7.19e-42
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020816   Gene: ENSMMUG00000015828   Transcript: ENSMMUT00000022248
Sequence length 481
Comment pep:known chromosome:MMUL_1:5:21060091:21215029:1 gene:ENSMMUG00000015828 transcript:ENSMMUT00000022248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSG
WKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHF
MLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVS
TRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMAL
PRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNK
EMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFT
PNLRVWFGDVEAETMYRCGESMLCVVPDISAFRQGWRWVRQPVQVPVTLVRNDGIIYSTS
LTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVV
S
Download sequence
Identical sequences ENSMMUP00000020816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]