SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020930 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020930
Domain Number 1 Region: 174-366
Classification Level Classification E-value
Superfamily vWA-like 3.06e-56
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 2 Region: 477-645
Classification Level Classification E-value
Superfamily Fibronectin type III 3.53e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 385-473
Classification Level Classification E-value
Superfamily Fibronectin type III 5.94e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 32-105
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000164
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 5 Region: 948-1022
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000057
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020930   Gene: ENSMMUG00000015912   Transcript: ENSMMUT00000022371
Sequence length 1297
Comment pep:known_by_projection chromosome:MMUL_1:10:1028402:1062678:-1 gene:ENSMMUG00000015912 transcript:ENSMMUT00000022371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRAPAHLGLGLCLWLWLSTTLGREQGPASGHLRLTVLPEDRLQMKWRESEGSGLGYLV
QVQPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRFLLARREFVIEDLKS
SSLDRNNQRPLSNGAPEPTPSLMGSSDPEQASEPRVAFVPSRDPPIPGGSEWRESNPQFR
CLPPVPADMVFLVDGSWSIGHSHFQQVKDFLASVIAPFEIGPDKVQVGLTQYSGDAQTEW
NLNSFGTKEQVLAAVHRLRYKGGNTFTGLALTHVLGQNLQPAAGLRPEAAKVVILVTDGK
SQDDVHTAARVLKDLGVNIFAVGVKNADEAELRLLASPPRDITVHNVLDFPQLGALAGLL
SRLICQRLQDGGPRRGPAAAPALDTLPAPTGLVLSQVTSSSIHVSWTPAPRLPLKYLIVW
RASRGGTPREVVVEGPAASAELHNLTSRTEYLVSVFPIYEGGVGEGLRGLVTTAPLSPPR
ALTLATVTPRTIHLTWQPSAGATHYLVRCSPASSKGEEEEREVQVRWPEVLLDGLEPGRD
YEISVQSLRGPESSEARGIRARTPVLAPPRHLGFSDVSHDTVRVIWEGAPRPVRLVRVTY
VSSEGGHSGQTETPGNATSAVLGPLSSSTTYTVRVTCLYPGGGSSTLTGQVTTSWDWGPG
EGSSSYPTRQFTSSVVGACPGLVLSQVWAPDGCDGWGYRVLLGVAAPSLRHPDSGAPQPV
SRLPSEKVPSPSQLSMTELPGDTVQLAWAQLAAARSHLLHPFPGSREEVPDLLPPRPQGC
LAGGHLRPAGSEEDFLRELPQGPGRLQFTPLSPVPPALGQPSPRGPCWIPTPLSRRAGPS
LGGKVDLGLCPSTQLFHLNWSRRASQPVSLGPTDPGGSCSRCHLVHFTEGKRRHSKGELS
QGPPKPKGRLLTPGPGDGCYSPAVAWPWGLRWALALPGLWGTSRAVSQVHVAVGRSKVGL
YVDCRKVAERPLGEVGSAPSAGFITLGRLAKARGPRSSSAVFQLQTLQIVCSDTWADEDR
CCELPASRDGETCPAFVSACSCSSETPGPPGPQGPPGLPGRNGTPGEQGFPGPRGEPGPP
GQMGPEGPGGQQGSPGTQGRAVPGPVGPPGVKGEKGDHGLPGLQGHPGHQGIPGRVGLQG
PKGMRGLEGTAGLPGPPGPRGFQGMAGARGTGGERGPPGAVGPTGLPGPKGERGEKGEPQ
SLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALL
PGEWRHGSRHLEGRGEPGAVGQTGSPGQQGSTQGLWE
Download sequence
Identical sequences ENSMMUP00000020930 ENSMMUP00000020930 9544.ENSMMUP00000020930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]