SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020955 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020955
Domain Number 1 Region: 144-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 312-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 88-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000209
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020955   Gene: ENSMMUG00000015929   Transcript: ENSMMUT00000022396
Sequence length 382
Comment pep:known_by_projection chromosome:MMUL_1:3:60430360:60435131:1 gene:ENSMMUG00000015929 transcript:ENSMMUT00000022396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPEMVAKHSVMFYYFAQHLWPEQNVRDSFQKVTLRRYRKCGYENLKLRKGCKSVVECK
QHKGDYSGLNQCLKTTLNKIFQDKYVKVFHKISNSNRHKMRHTENKHFKCKECGKTFCML
SHLTQHKRIHIRVNFYKYEECGRAFNWSSTLNKHKRIHMREKPYKCKECGKAFNQTSHLV
RHKRIHTEEKPYKCEECGRAFNQSSTLTTHNTIHTGGKPCKCEKCDRAFKQASKLTEHKL
IHTGEKPYKCKECGKVFNQSSNLTEHKKIHTGEKSYKCEECGKAFNRSSTLTKYKVIHTG
EKPYKCKECGKAFKQFSHLAVHKIIHTGEKLYKCEERGKAFNLSSNLTAHKKNHTGVKPY
KCEECGKANLSSTLTPRKTIHT
Download sequence
Identical sequences ENSMMUP00000020955 9544.ENSMMUP00000020955 ENSMMUP00000020955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]