SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021002 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021002
Domain Number 1 Region: 288-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-40
Family variant C2H2 finger 0.015
Further Details:      
 
Domain Number 2 Region: 212-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-17
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021002   Gene: ENSMMUG00000015965   Transcript: ENSMMUT00000022449
Sequence length 456
Comment pep:known_by_projection chromosome:MMUL_1:3:149597892:149743504:1 gene:ENSMMUG00000015965 transcript:ENSMMUT00000022449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASKTQGAVVRMEEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPC
IFCEEHFPVAEQDKLLKHMIIEHKIVIADIKLVADFRRYILYWRKRFTEQPITDFCSVIR
INSTAPFEEQENYFLLCDVLPEDRILREELQKQRLKEILEQQQQERNDTNFHGICMFCNE
EFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLK
DHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDWSDWEEHPA
SAVCLFCEKQAETIEKLYVHMEDAHEFDLLKIKSELGLNFYQQVKLVNFIRRQVHQCRCY
GCHVKFKSKADLRTHMEETKHTSLLPDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQ
EQNENVPIISEDTSKLYALKQSSILNQLLLQECLKN
Download sequence
Identical sequences G7P2H1
9544.ENSMMUP00000021002 ENSMMUP00000021002 XP_001099338.1.72884 XP_005550604.1.63531 ENSMMUP00000021002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]