SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021015 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021015
Domain Number - Region: 253-342
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000875
Family Gamma-glutamyltranspeptidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021015   Gene: ENSMMUG00000015977   Transcript: ENSMMUT00000022465
Sequence length 350
Comment pep:known chromosome:MMUL_1:20:72261322:72278499:1 gene:ENSMMUG00000015977 transcript:ENSMMUT00000022465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYAGLQRL
SKEGLSGKSCTCRRCMGDTGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRFTY
APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Download sequence
Identical sequences A0A0D9QWQ8 A0A2K5LKN8 A0A2K6DQT5 G7Q1L7 H9YVE0
NP_001253270.1.72884 XP_005592577.1.63531 XP_007991847.1.81039 XP_011755834.1.29376 XP_011893001.1.92194 XP_011893057.1.92194 ENSMMUP00000021015 ENSMMUP00000021015 9544.ENSMMUP00000021015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]