SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021030
Domain Number 1 Region: 413-602
Classification Level Classification E-value
Superfamily VPS9 domain 2.48e-36
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 56-162
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000148
Family SH2 domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021030   Gene: ENSMMUG00000015987   Transcript: ENSMMUT00000022480
Sequence length 783
Comment pep:known chromosome:MMUL_1:14:8115620:8120077:1 gene:ENSMMUG00000015987 transcript:ENSMMUT00000022480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGESGTGPPGAPSPSSFTPGHLETEKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRE
RLLLTRPVWLQLQANAAAALHVLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSH
YILESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAIHRAATHKELEAISHL
GIEFWSSSLNIKAQRGPAGGPVLPQLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREK
FKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTERLPPCQLLRRESSVGYRVPAG
GDPSLPPMPSLQEVDCGSPSSSEEEGAPGSRGSPATSPHLGRRRPLLRSMSAAFCSLLAP
ERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSVELGPE
KLLPPKRLEHVLEKSLHRSVLKPLRPILAARVRRRLAADGSLGRLAEGLRLARAQGPGAF
GSHLSLPSPVEMEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEDAGADEFL
PLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPL
SPSQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCA
TKFRVTQPNTFGLFLYKDQGYHRLPPGALARRLPTTGYLVYRRAEWPETQEAATEKEGRG
QSEARSRGEEQGCQGDEDAGVKASPRDTREESDTTAEGGQGRAREGPAQPGEPEAEGSQA
AEE
Download sequence
Identical sequences 9544.ENSMMUP00000021030 ENSMMUP00000021030 ENSMMUP00000021030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]