SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021235 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021235
Domain Number 1 Region: 160-256
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000139
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 2 Region: 76-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000503
Family C1 set domains (antibody constant domain-like) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021235   Gene: ENSMMUG00000016149   Transcript: ENSMMUT00000022700
Sequence length 328
Comment pep:known chromosome:MMUL_1:6:47914968:47964743:-1 gene:ENSMMUG00000016149 transcript:ENSMMUT00000022700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALPGLLAARAPTPRLLLLLQCLLATARPSSADGSAPDLPFTSLPLREEMMANNFSWES
HNISLTEHSSMPVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDSEQLENNYLVSAT
GSTLYTQYRFTIINSKQMGSYSCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTVLT
CKCQNCFPLNWTWYSTNGSVKVPVGVQMNKYVINGTYANETKLKITQLLEEDGGSYWCHA
LFQVGESEEHIELVVLSYLVPLKPFLAIVAEVVLLVAAILLCEKYTQKEKKHSDEGKEFE
QTEQLKSDDSNGIENNVPRHRKNESLGQ
Download sequence
Identical sequences F7FTT3
ENSMMUP00000021235 9544.ENSMMUP00000021235 ENSMMUP00000021235 XP_001093157.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]