SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021274
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-30
Family Nuclear receptor 0.00013
Further Details:      
 
Domain Number 2 Region: 72-86,221-289
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000105
Family Nuclear receptor ligand-binding domain 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021274   Gene: ENSMMUG00000016188   Transcript: ENSMMUT00000022745
Sequence length 323
Comment pep:known chromosome:MMUL_1:1:170430690:170444167:-1 gene:ENSMMUG00000016188 transcript:ENSMMUT00000022745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPY
CRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVI
QAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQT
YGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQA
KIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKGLTLSPRLEC
SGSWLTATSASCVQVIRLPQPPE
Download sequence
Identical sequences ENSMMUP00000021274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]