SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021288 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021288
Domain Number 1 Region: 53-237
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.6e-79
Family T-box 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021288   Gene: ENSMMUG00000016202   Transcript: ENSMMUT00000022761
Sequence length 518
Comment pep:known chromosome:MMUL_1:11:115290284:115343614:-1 gene:ENSMMUG00000016202 transcript:ENSMMUT00000022761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSGYPQ
QQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPG
TLQPPEFLYSHGMPRTLSPHQYHSVHGVGMVPEWSDNS
Download sequence
Identical sequences A0A2K5VPD0 F7FPV2
9544.ENSMMUP00000015631 ENSMMUP00000015631 ENSMMUP00000015631 ENSMMUP00000021288 XP_001111737.1.72884 XP_005572391.1.63531 XP_005572392.1.63531 XP_015008378.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]