SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021403 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021403
Domain Number 1 Region: 106-302
Classification Level Classification E-value
Superfamily L domain-like 3.47e-28
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 587-698
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.43e-27
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021403   Gene: ENSMMUG00000016293   Transcript: ENSMMUT00000022884
Sequence length 737
Comment pep:known_by_projection chromosome:MMUL_1:17:25373594:25567842:1 gene:ENSMMUG00000016293 transcript:ENSMMUT00000022884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHHHHHHQHHGGTGAPGGAGGGGGGSGGF
NLPLNRGLERALEEANSGGLNLSRKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELC
HFVSLEILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKL
GSLPEEIGQLKQLMELVSYQGIQKNFSRQLDKVEPLLQLNVRRNYLKVLPQELVDLPLVK
FDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTT
DSLYLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEE
EQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKAR
FSGSTMTEDCEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTD
ITERSVLNLYPMGSAEALELQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIREN
SPAVSPTTNSTAPFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELVEQLRESIE
MRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLE
ACRKLGVPEADLCSPYDILQLDFRHIRKTVDTLLALGEKAPPPTSALRSRDLIGFCLVHI
LFIVLVYITYHWNALSA
Download sequence
Identical sequences 9544.ENSMMUP00000021403 ENSMMUP00000021404 ENSMMUP00000021403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]