SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021441
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily Tropomyosin 2.81e-99
Family Tropomyosin 0.000000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021441   Gene: ENSMMUG00000016321   Transcript: ENSMMUT00000022923
Sequence length 284
Comment pep:known chromosome:MMUL_1:15:41831482:41838900:1 gene:ENSMMUG00000016321 transcript:ENSMMUT00000022923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Download sequence
Identical sequences A0A096P175 A0A2I3S1S3 A0A2J8T0D6 A0A2K5F4K8 A0A2K5KBE1 A0A2K5NJM6 A0A2K5Q891 A0A2K5TXJ6 A0A2K5ZGF4 A0A2K6BU83 A0A2K6KH18 A0A2K6R4Y7 A0A2K6SQN1 F7IEI5 G1QWA1 I2CVI9 P07951
ENSCJAP00000017708 ENSNLEP00000023610 ENSP00000354219 9606.ENSP00000354219 ENSMMUP00000021441 gi|42476296|ref|NP_003280.2| NP_003280.2.87134 NP_003280.2.92137 XP_003777398.1.23681 XP_003943845.1.74449 XP_005581418.1.63531 XP_007967001.1.81039 XP_010374579.1.97406 XP_011746477.1.29376 XP_011805842.1.43180 XP_011835522.1.47321 XP_011942489.1.92194 XP_012318738.1.9421 XP_012364377.1.23891 XP_014972968.1.72884 XP_016816317.1.37143 XP_016870580.1.92137 XP_017398595.1.71028 XP_017713231.1.44346 ENSP00000354219 ENSPANP00000019100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]