SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021488 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021488
Domain Number 1 Region: 279-514
Classification Level Classification E-value
Superfamily PRTase-like 6.03e-62
Family Phosphoribosyltransferases (PRTases) 0.00000682
Further Details:      
 
Domain Number 2 Region: 12-286
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.97e-59
Family Class II glutamine amidotransferases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021488   Gene: ENSMMUG00000016362   Transcript: ENSMMUT00000022976
Sequence length 517
Comment pep:known chromosome:MMUL_1:5:72944893:72985771:1 gene:ENSMMUG00000016362 transcript:ENSMMUT00000022976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEELGVREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVRTLDIISRSEGNPMAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Download sequence
Identical sequences A0A2K5J9S9 A0A2K6DDR8 A0A2K6MBH2 A0A2K6RMV5 F7GPV9 G7P5S2
NP_001247748.1.72884 XP_005555286.1.63531 XP_010353533.1.97406 XP_011709031.1.29376 XP_011816630.1.43180 XP_017704721.1.44346 ENSMMUP00000021488 9544.ENSMMUP00000021488 ENSMMUP00000021488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]