SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021528 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021528
Domain Number - Region: 80-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000377
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 154-186
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit X, PsaK 0.0902
Family Photosystem I reaction center subunit X, PsaK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021528   Gene: ENSMMUG00000016394   Transcript: ENSMMUT00000023016
Sequence length 437
Comment pep:known chromosome:MMUL_1:3:122605828:122677653:1 gene:ENSMMUG00000016394 transcript:ENSMMUT00000023016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPRWWELGDPCAWTGQGRGTRRMSPATTGTFLLTVYTIFSKVHSDRNVYPSAGVLFVH
VLEREYFKGEFPPYPKPGEISNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTA
ENVGKPTIIEITAYNRRTFETARHNLIINIMSAEDFPLPYQAEFFIKNMNVEEMLASEVL
GDFLGAVKNVWQPERLNAINITSALDRGGRVPLPINDLKEGVYVMVGADVPFSSCLREVE
NPQNQLRCSQEMEPVITCDKKFRTQFYIDWCKISLVDKTKQVSTYQEVIRGEGILPDGGE
YKPPSDSLKSRDYYTDFLITLAVPSAVALVLFLILAYIMCCRREGVEKRNMQTPDIQLVH
HSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNL
PHQTQIPQQQTTGKWYP
Download sequence
Identical sequences A0A2K5IEX6 A0A2K5KIW5 A0A2K5Z6G5 A0A2K6E6E6 I0FW55 Q4R5B1
ENSMMUP00000021528 XP_005550257.1.63531 XP_007980321.1.81039 XP_011729164.1.29376 XP_011810479.1.43180 XP_011830068.1.47321 XP_011929284.1.92194 XP_014989766.1.72884 ENSMMUP00000021528 9544.ENSMMUP00000021528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]