SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021530 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021530
Domain Number - Region: 56-129
Classification Level Classification E-value
Superfamily Cadherin-like 0.000361
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 130-162
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit X, PsaK 0.0876
Family Photosystem I reaction center subunit X, PsaK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021530   Gene: ENSMMUG00000016394   Transcript: ENSMMUT00000023018
Sequence length 427
Comment pep:known chromosome:MMUL_1:3:122605933:122677463:1 gene:ENSMMUG00000016394 transcript:ENSMMUT00000023018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPATTGTFLLTVYTIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDP
ITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARH
NLIINIMSAEDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSA
LDRGGRVPLPINDLKEGVYVMVGADVPFSSCLREVENPQNQLRCSQEMEPVITCDKKFRT
QFYIDWCKISLVDKTKQVSTYQEVIRGEGILPDGGEYKPPSDSLKSRDYYTDFLITLAVP
SAVALVLFLILAYIMCCRREGVIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPV
TGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGDFRLTTFQRFEVNGIPEERK
LTEAMNL
Download sequence
Identical sequences ENSMMUP00000021530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]