SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021633 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021633
Domain Number 1 Region: 176-236
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-19
Family Erythroid transcription factor GATA-1 0.00012
Further Details:      
 
Domain Number 2 Region: 128-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000713
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021633   Gene: ENSMMUG00000016464   Transcript: ENSMMUT00000023125
Sequence length 340
Comment pep:known_by_projection chromosome:MMUL_1:X:46656361:46658664:1 gene:ENSMMUG00000016464 transcript:ENSMMUT00000023125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQVYPLLNCMEGIPGGSPYASWAYGKTGLYPASTVCPTREDSPPQATEDPDGKGSTSFL
ETLKTERLSPDLLTLGPALPSSLPIPNSAYGGPDFSSTFFSPTGSPLSSAAYSSPKLRGT
LPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKR
AGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKG
KKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVTSGLTLGPPGTAHLYQGLGPVVLS
GPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSATVVAPLSS
Download sequence
Identical sequences 9544.ENSMMUP00000021633 ENSMMUP00000021633 ENSMMUP00000021633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]