SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021635 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021635
Domain Number 1 Region: 71-262
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.66e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 450-515
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.34e-20
Family SAM (sterile alpha motif) domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 298-338
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000366
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021635   Gene: ENSMMUG00000016466   Transcript: ENSMMUT00000023127
Sequence length 586
Comment pep:known chromosome:MMUL_1:2:182109879:182214921:1 gene:ENSMMUG00000016466 transcript:ENSMMUT00000023127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLENNAQTQFSEPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSS
TFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIK
VMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQ
YVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQV
LGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRR
SPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQ
SQSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAG
DMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIY
QIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETR
GERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences A0A2J8WI20 A0A2K5VC74 A0A2K6KGC8 A0A2K6NHJ7 F7GBG7 G1R4S5
ENSMMUP00000021635 XP_002814455.1.23681 XP_003256693.1.23891 XP_010384155.1.97406 XP_011816995.1.43180 XP_017728919.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]