SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021636 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021636
Domain Number 1 Region: 165-356
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.16e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 392-432
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000288
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021636   Gene: ENSMMUG00000016466   Transcript: ENSMMUT00000023128
Sequence length 487
Comment pep:known chromosome:MMUL_1:2:181952888:182200928:1 gene:ENSMMUG00000016466 transcript:ENSMMUT00000023128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKHLLSACFRNELVEPRRETPKQSDVFFRHSNP
PNRSVYP
Download sequence
Identical sequences A0A2I3H7C7 A0A2I3MKF2 A0A2K5ESI9
ENSMMUP00000021636 XP_003256700.1.23891 XP_005545478.1.63531 XP_011721446.1.29376 XP_011816999.1.43180 XP_011892236.1.92194 XP_014987989.1.72884 XP_017728920.1.44346 XP_021527051.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]