SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021739 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021739
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.36e-95
Family Proteasome subunits 0.00000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021739   Gene: ENSMMUG00000016544   Transcript: ENSMMUT00000023236
Sequence length 246
Comment pep:known chromosome:MMUL_1:7:98246603:98274453:1 gene:ENSMMUG00000016544 transcript:ENSMMUT00000023236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Download sequence
Identical sequences A0A091DAZ6 A0A140VK44 A0A1S3ETR1 A0A1U7ULR6 A0A250YDK7 A0A2J8TI99 A0A2K6AT60 A0A2K6KC23 A0A2K6UCJ0 B9VR86 F2Z5N0 F7BRA4 G1T9V4 G2HIX7 G3RBL9 G3TIR5 G5B117 H0WYL3 H9YZY1 L5KIA6 L8IT35 M3WV20 P60900 P60901 Q2YDE4 Q4R6D8 U3DF73 W5PC09
1iruA ENSRNOP00000009666 10116.ENSRNOP00000009666 9544.ENSMMUP00000021739 9598.ENSPTRP00000010633 9606.ENSP00000261479 9796.ENSECAP00000019847 9823.ENSSSCP00000002132 9913.ENSBTAP00000012773 9986.ENSOCUP00000013427 ENSLAFP00000014558 ENSOGAP00000007607 ENSTSYP00000000197 ENSSARP00000007029 ENSSSCP00000002132 ENSOCUP00000013427 ENSGGOP00000012880 ENSSSCP00000002132 1iru_A 1iru_O 5a0q_A 5a0q_O 5gjq_B 5gjq_h 5gjr_B 5gjr_h 5l4g_A 5l4g_N 5le5_G 5le5_U 5lex_G 5lex_U 5ley_G 5ley_U 5lez_G 5lez_U 5lf0_G 5lf0_U 5lf1_G 5lf1_U 5lf3_G 5lf3_U 5lf4_G 5lf4_U 5lf6_G 5lf6_U 5lf7_G 5lf7_U 5ln3_A 5m32_G 5m32_U 6avo_K 6avo_R 6epc_A 6epd_A 6epe_A 6epf_A ENSP00000261479 gi|23110944|ref|NP_002782.1| NP_001039427.1.59421 NP_001039427.1.76553 NP_001180482.1.72884 NP_001233586.1.37143 NP_001271993.1.63531 NP_001272627.1.57651 NP_002782.1.87134 NP_002782.1.92137 NP_058979.1.100692 NP_058979.1.4139 XP_001491320.1.31192 XP_002718187.1.1745 XP_003408905.1.64505 XP_003792017.1.62490 XP_003821244.1.60992 XP_003987590.1.62641 XP_004055136.2.27298 XP_004270016.1.21590 XP_004319607.1.83887 XP_004376568.1.4749 XP_004681993.1.23501 XP_004867614.1.39548 XP_005376980.1.28644 XP_005891864.1.15283 XP_006043909.1.26621 XP_006186437.1.101512 XP_006212818.1.17985 XP_006913536.1.64745 XP_007073792.1.5354 XP_007119012.1.24612 XP_007464884.1.90284 XP_007936738.1.48129 XP_007984674.1.81039 XP_008069643.1.4292 XP_008511175.1.77740 XP_008572098.1.73410 XP_008831132.1.79516 XP_010631915.1.5607 XP_010833601.1.44457 XP_010966161.1.22495 XP_010984427.1.51371 XP_011374978.1.92234 XP_011733201.1.29376 XP_011781268.1.43180 XP_012591962.1.48125 XP_012867796.1.60039 XP_014708564.1.49734 XP_014917076.1.86478 XP_016007573.1.101085 XP_017358361.1.71028 XP_017524619.1.32401 XP_017714246.1.44346 XP_019281701.1.44245 XP_019839354.1.53367 XP_020036365.1.5219 XP_020726079.1.74333 XP_021057209.1.100879 XP_021530590.1.9421 ENSOGAP00000007607 ENSOARP00000007970 ENSECAP00000019847 Hs14749945___KOG0182 ENSFCAP00000018207 ENSTSYP00000000197 ENSPTRP00000010633 ENSLAFP00000014558 cath|current|1iruA00/2-245 cath|current|1iruO00/2-245 ENSP00000261479 ENSVPAP00000005289 ENSMMUP00000021739 ENSOCUP00000013427 ENSMMUP00000021739 ENSGGOP00000012880 ENSECAP00000019847 ENSVPAP00000005289 ENSSARP00000007029 HGL_H00000261479-1 ENSRNOP00000009666 ENSPTRP00000010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]