SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021769 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021769
Domain Number 1 Region: 115-306
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.81e-87
Family p53 DNA-binding domain-like 0.000000531
Further Details:      
 
Domain Number 2 Region: 346-386
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.000000000000419
Family p53 tetramerization domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021769   Gene: ENSMMUG00000016569   Transcript: ENSMMUT00000023268
Sequence length 554
Comment pep:known_by_projection chromosome:MMUL_1:1:6636050:6691684:1 gene:ENSMMUG00000016569 transcript:ENSMMUT00000023268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSTTTSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSTKNGAAGKRAFKQSPPAVPALGPGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPRWDAQQPWPRSASQRRDEQQP
QHPVHGLGVPLHSATPLPRRPQPRQVCGRGQSGEEHRRCWGNGPLRGKTPKADAAQQLLR
SSNAAAISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGAGPDEWADFGFDLPDCKAR
KQPIKEEFTEAEIH
Download sequence
Identical sequences ENSMMUP00000021769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]