SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021783 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021783
Domain Number 1 Region: 52-169
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-32
Family C-type lectin domain 0.00000548
Further Details:      
 
Domain Number 2 Region: 265-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000514
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 210-275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 170-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021783   Gene: ENSMMUG00000016579   Transcript: ENSMMUT00000023282
Sequence length 375
Comment pep:known chromosome:MMUL_1:1:199407844:199417824:-1 gene:ENSMMUG00000016579 transcript:ENSMMUT00000023282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRRTREGPSKAMIFPRKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSENP
MNWQKARRFCRENYTDLVAIQNKAEIEYLEKTLPFSPSYYWIGIRKIGGIWTWVGTNKSL
TQEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKPKAALCYTASCQPWSCSG
HGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEPPKLGTMDCTHPLGDFSFSSQCAFNC
SEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFSSACTF
SCSEGTELIGEKKTICESSGIWSNPNPICQKLDRSFSMIKEGDYNPLFIPVAVMVTAFSG
LAFIIWLARRLKKGM
Download sequence
Identical sequences G7MFA6 G8F369
ENSMMUP00000021783 9544.ENSMMUP00000021783 ENSMMUP00000021783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]