SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021809 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000021809
Domain Number 1	Region: 15-77
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	1.09e-18
Family	LIM domain	0.0012
Further Details:

Domain Number 2	Region: 74-140
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.81e-18
Family	LIM domain	0.0011
Further Details:

Domain Number 3	Region: 136-164
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000598
Family	LIM domain	0.0012
Further Details:

Weak hits

Sequence:	ENSMMUP00000021809
Domain Number -	Region: 1-13
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0533
Family	LIM domain	0.011
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000021809 Gene: ENSMMUG00000016594 Transcript: ENSMMUT00000023309
Sequence length	165
Comment	pep:known chromosome:MMUL_1:13:105248723:105325242:-1 gene:ENSMMUG00000016594 transcript:ENSMMUT00000023309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGV TYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGT KYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences	ENSMMUP00000021809 NP_001305826.1.87134 NP_001305826.1.92137 NP_001305827.1.87134 NP_001305827.1.92137

SEARCH