SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021812 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021812
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.83e-18
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 68-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000103
Family LIM domain 0.0029
Further Details:      
 
Domain Number 4 Region: 7-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000171
Family LIM domain 0.019
Further Details:      
 
Domain Number 5 Region: 250-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000134
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021812   Gene: ENSMMUG00000016594   Transcript: ENSMMUT00000023312
Sequence length 279
Comment pep:known chromosome:MMUL_1:13:105248723:105325242:-1 gene:ENSMMUG00000016594 transcript:ENSMMUT00000023312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERFDCHHCNESLFGKKYILREESPYCVACFETLFANTCEECGKPIGCDCKDLSYKDRH
WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP
WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences A0A0D9RWX3 A0A2K5HTS7 F7GXH4 G7PMV9
ENSMMUP00000021809 ENSPANP00000003788 ENSMMUP00000021812 ENSMMUP00000021815 ENSMMUP00000021816 ENSMMUP00000036195 XP_001109039.1.72884 XP_005575239.1.63531 XP_008006477.1.81039 XP_008006478.1.81039 XP_008006479.1.81039 XP_010359284.1.97406 XP_010359285.1.97406 XP_011753830.1.29376 XP_011812015.1.43180 XP_011812016.1.43180 XP_011812017.1.43180 XP_011824944.1.47321 XP_011824946.1.47321 XP_011824947.1.47321 XP_011824948.1.47321 XP_011910872.1.92194 XP_011910874.1.92194 XP_011910875.1.92194 XP_014968530.1.72884 XP_017730527.1.44346 XP_017730528.1.44346 9544.ENSMMUP00000021816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]