SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021867 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021867
Domain Number 1 Region: 249-437,546-588
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-59
Family FAD-linked reductases, N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 422-536
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.21e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021867
Domain Number - Region: 192-245
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000663
Family SWIRM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021867   Gene: ENSMMUG00000018575   Transcript: ENSMMUT00000023370
Sequence length 589
Comment pep:known chromosome:MMUL_1:4:18206673:18268427:1 gene:ENSMMUG00000018575 transcript:ENSMMUT00000023370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
ACPVCFASASERELSGDSAKWVHRWCSYFFSLQVLERLFSSHKDGYDKYTTWKKIWTSNG
KTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPET
SDHCSLPEDLEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGADQ
YLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVG
RGAQIVNGCINNPVALMCEQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIR
LKSPVQSVDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINS
LGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVI
AGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTG
GSGEAYDIIAEDIQGTIFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences ENSMMUP00000021867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]