SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021926 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021926
Domain Number 1 Region: 407-512
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021926   Gene: ENSMMUG00000016668   Transcript: ENSMMUT00000023432
Sequence length 1160
Comment pep:known chromosome:MMUL_1:13:62895302:63224508:1 gene:ENSMMUG00000016668 transcript:ENSMMUT00000023432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSIN
MKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDSDV
AELNPFGDPDSEEPITETASPRRTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDS
PPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPSPNNLVNPIQELETER
RVKRKAPAPPVLSPKTGGVNENTVSAGKDLSTSPKPSPIPSPVLGRKPNASQSLLVWCKE
VTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIG
ISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDT
NSSVDQEKFYAELSDLKREPELQQPISGAVDFLSQDDSVFVNDSGVGESESERQTPDDHL
SPSTASPYCRRTKSDTEPQKSQQSSGRTSGSDDPGICSNTDSTQAQVLLGKKRLLKAETL
ELSDLYVSDKKKDMSPPFICEETDEQKLQTLDISSNLEKEKLENSRSLECRSDPESPIKK
TSLSPTSKLGYSYSRDLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRMLSRQE
ELKERARVLLEQARRDAALKAGNKHSTNAATPFCNRQLSDQQDEERRRQLRERARQLIAE
ARSGVKMSELPSYGEMAAEKLKERSKACGEQNSKLVDLKLKKLLEVQPQVANSPSSAAQK
AVTESSEQDIKNGTEDLRTERLQKTTERFRSPVVFSKDSTVRKTQLQSFSQYIENRPEMK
RQRSIQEDTKKGNEEKAAITETQRKPSEDEVLNKGFKDTSQYVVGELAALENEQKQIDTR
AALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNALIRRMNQLSLLEKEHDLERRYEL
LNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVNKRDALVRDLDAQEKQAEEEDEHLE
RTLEQNKGKMAKKEEKCVLQ
Download sequence
Identical sequences XP_005575826.1.63531 XP_014967969.1.72884 ENSMMUP00000021926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]