SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021984 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021984
Domain Number 1 Region: 244-372
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 40-151
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.00042
Further Details:      
 
Domain Number 3 Region: 362-475
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000942
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000214
Family Cadherin 0.0051
Further Details:      
 
Domain Number 5 Region: 178-256
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021984   Gene: ENSMMUG00000016727   Transcript: ENSMMUT00000023498
Sequence length 749
Comment pep:known_by_projection chromosome:MMUL_1:20:65198849:65208830:-1 gene:ENSMMUG00000016727 transcript:ENSMMUT00000023498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAWLWLLCISVPQVTLETQDRRVLWGPQPVLVRVKDENDQVPHFSQAIYRAQLSRGTR
PGIPFLFLEASDQDEPGTANSDLRFRILSQAPAQPFPDMFQLEPRQGALALSPKGSTSLD
HALEKTYQLLVQVKDMGDQASGHQAIATVEVSIIESTWVPLEPIHLAENLKVLYPHHIAQ
VHWSGVDVHYRLESHPLGPFDVDAEGNLYVTRELDTEAQAEYVLQVWAQNSRGEDYAAPL
ELHVLVMDENDNVPVCPPRGPAVSIPELSPPGTEVTRLSAEDADAPGSPNSHIVYQLLNP
ESEDGVEGRAFQVDSTSGSVTLGALPLQAGQNILLLVLAMDLAGAEGGFSSTCEVEVEVT
DINDHAPEFTTSQIGPISLPEDVEPGTLVAMLTATDADLEPAFRLMDFAIERGDMDGTFD
LDWEPDSGHVGLRLCKNLSYEAAPSHKVVVVVRSVAELVGPGPGPGATATVTVLVERVMP
PPKLDQERYEASVPISAPAGSLLLTIQPSDPISRSLRFSLVNDSEGWLCIEKVSGEVHTA
QSLQGTQPGDTYTVLVEAQDTDEPRLSTSVPLVIHFLKAPPAPALTPAPVPSRYLCTPRQ
DHGVIVSGPSKDSDLASGHGPYSFALGPNPTVQRDWRLQTLNGSHAYLTLALHWVEPREH
IIPVVVSHNAQMWQLLVRVIVCRCNVEGQCMRKVGRMKGMPTKLSAVGILVGTLVAIGIF
LILIFTHWTLSRKKDLNQPADSVPLKATV
Download sequence
Identical sequences A0A2K6E2A6 F6VCT3
ENSMMUP00000021984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]