SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022051 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022051
Domain Number 1 Region: 4-448,560-612
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-83
Family GDI-like N domain 0.00000000000122
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.51e-41
Family GDI-like 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022051   Gene: ENSMMUG00000016776   Transcript: ENSMMUT00000023568
Sequence length 653
Comment pep:known_by_projection chromosome:MMUL_1:X:84676947:84861072:-1 gene:ENSMMUG00000016776 transcript:ENSMMUT00000023568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EHQENSDIENDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSANSTEAADSSFLPMEDESLSTMNCEMLTEQTPSSDPENALEVNGAEVTGEKEN
HCDDKTCVPSTSAEDVSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKYPDEYKGYEDITFYEYLKTQKLTPNLQYIVLHSIAMTSETASSTIDGLKATRN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISEHFLVEDSYFSENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGMFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLEPVVQKLFIPYTEMEIENEQ
VEKPRILWALYFNMRDSSDISRSCYKDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICP
SEDFCPPPPNPEDIVLDGDGLQPEASESSAIPEANSKTFKESTNLGNLEESSE
Download sequence
Identical sequences ENSMMUP00000022051 ENSMMUP00000022051 9544.ENSMMUP00000022051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]