SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022160 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022160
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.18e-194
Family Myeloperoxidase-like 0.0000000000000142
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000876
Family EGF-type module 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022160   Gene: ENSMMUG00000016857   Transcript: ENSMMUT00000023682
Sequence length 604
Comment pep:known chromosome:MMUL_1:1:184027392:184035196:1 gene:ENSMMUG00000016857 transcript:ENSMMUT00000023682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARALLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDNFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
Download sequence
Identical sequences A0A2K6AJ55 G7MF20 G7NXE8
9544.ENSMMUP00000022160 ENSMMUP00000022160 ENSMMUP00000022160 XP_001107538.2.72884 XP_011854550.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]