SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022180 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022180
Domain Number 1 Region: 158-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000228
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000396
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022180
Domain Number - Region: 331-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022180   Gene: ENSMMUG00000016872   Transcript: ENSMMUT00000023702
Sequence length 491
Comment pep:known_by_projection chromosome:MMUL_1:13:56179033:56234522:-1 gene:ENSMMUG00000016872 transcript:ENSMMUT00000023702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGHEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEVQAGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEVWNKVQS
LCYIAFLVCYQEKGKESRCPHTSFLANRICINECETTNECREDEMCWNYHGGFRCYPRNP
CQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYANTIN
TFRIKSGNENXXXXXXXKSLIPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVL
RLTIIVGPFSF
Download sequence
Identical sequences ENSMMUP00000022180 9544.ENSMMUP00000022180 ENSMMUP00000022180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]