SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022198 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000022198
Domain Number - Region: 276-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000171
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 246-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000431
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 181-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 310-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022198   Gene: ENSMMUG00000016887   Transcript: ENSMMUT00000023720
Sequence length 379
Comment pep:known chromosome:MMUL_1:11:62084258:62155801:-1 gene:ENSMMUG00000016887 transcript:ENSMMUT00000023720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSAFAAAAFWLWSILLCLLALRAEAGQPREESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFHGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYGASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
Download sequence
Identical sequences F7BIX5
ENSMMUP00000022198 ENSMMUP00000022198 9544.ENSMMUP00000022198 NP_001247600.1.72884 XP_015286640.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]