SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022213 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022213
Domain Number 1 Region: 112-251
Classification Level Classification E-value
Superfamily dUTPase-like 3.53e-49
Family dUTPase-like 0.000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022213   Gene: ENSMMUG00000016898   Transcript: ENSMMUT00000023735
Sequence length 252
Comment pep:known_by_projection chromosome:MMUL_1:7:26659881:26670774:1 gene:ENSMMUG00000016898 transcript:ENSMMUT00000023735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAGLSGPGPPLGRAAQHGTPWRLSSA
GSLSRGCRGASTAGAAGWKGELPKPGGCPAPGQETPAISPSKRPRPAEEGGMQLRFARLS
DHATAPTRGSARAAGYDLYSAYDYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKY
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
Download sequence
Identical sequences ENSMMUP00000022213 9544.ENSMMUP00000022213 ENSMMUP00000022213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]