SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022215 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022215
Domain Number 1 Region: 16-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.71e-41
Family Gelsolin-like 0.00000651
Further Details:      
 
Domain Number 2 Region: 377-520
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.78e-39
Family Gelsolin-like 0.0000336
Further Details:      
 
Domain Number 3 Region: 612-731
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.27e-37
Family Gelsolin-like 0.0000248
Further Details:      
 
Domain Number 4 Region: 251-436
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.14e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 5 Region: 513-612
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.71e-26
Family Gelsolin-like 0.0003
Further Details:      
 
Domain Number 6 Region: 752-827
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.1e-23
Family VHP, Villin headpiece domain 0.00011
Further Details:      
 
Domain Number 7 Region: 122-233
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.32e-22
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022215   Gene: ENSMMUG00000016899   Transcript: ENSMMUT00000023737
Sequence length 827
Comment pep:novel chromosome:MMUL_1:12:82256104:82288650:1 gene:ENSMMUG00000016899 transcript:ENSMMUT00000023737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASNLSY
DIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMNHVETNSYDVQRLLHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGP
ESNRMERLRGMTLAKEIRDQERGGRTYVGVVDGENESASPKLMEVMNHVLGKRGELKAAV
PDTVVEPALKAALKLYHVSDAEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSDLGK
THTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH
FYGGDCYLLLYTYLIGNKQHYLLYIWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVP
MGKEPPHLMSIFKGRMVVYQGGTSRANNLEPGPSTRLFQVQGTGANNTKAFEVPARANFL
NSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGG
KAPYANTKRLQEENLVITPRLFECSNQTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFF
WIGKHANEEEKKAAAITAQEYLKTHPSGRDPETPIIVVKQGYEPPTFTGWFLAWDPFKWS
NAKSYEDLKVELGNSRDWSQITAEVTSSKVDVFNANSNLSSGSRPIFPLEQLVNKPVEEL
PEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF
Download sequence
Identical sequences F7CQ79
XP_001090524.1.72884 9544.ENSMMUP00000022215 ENSMMUP00000022215 ENSMMUP00000022215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]