SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022254 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022254
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 316-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000809
Family Laminin-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022254
Domain Number - Region: 481-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 94-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00168
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 
Domain Number - Region: 962-1050
Classification Level Classification E-value
Superfamily Tropomyosin 0.00271
Family Tropomyosin 0.006
Further Details:      
 
Domain Number - Region: 835-904
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0201
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022254   Gene: ENSMMUG00000016925   Transcript: ENSMMUT00000023777
Sequence length 1127
Comment pep:known_by_projection scaffold:MMUL_1:1099214727510:2148:37513:-1 gene:ENSMMUG00000016925 transcript:ENSMMUT00000023777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQHG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NVRLNGGKVQLNLMDLASGIPATQSKKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTTVQVHDVCVCQHNTAGPNCERCAPFYNNR
PWRPAEGRDTHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDVPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCDKASGRCLCRAGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRLG
SLRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSAAVTEQEVAQVASAILSLRK
QAQIGDPDLPLEEETLSLLRDLESLDRSFNGLLTMYQRKREQFEKLSSADPSGAFRMLTT
AYEQSAQAAQQVSDSSHLLDQLRDSRREAERLAQQAGGGGGTGSPQLVALRLEMSSLPDL
TPTFNKLCGSSRQMACTPGSCPGELCPHDNGTACGSYCRGVLPRAGGAFWTAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQRLETQVSTSRSQMEEDVRRTRLLIQQVRDFLT
DPETDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLQPAEKLVTSMTKQLGDFWTRMEELRRQARQQRAQAVQAQQLAEGASEQALSAQEGFER
IKQKYAELKDRLGQSPTLGEQGARIQSVKTEAEELFGETMEMMDRMK
Download sequence
Identical sequences 9544.ENSMMUP00000022254 ENSMMUP00000022254 ENSMMUP00000022254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]