SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022384 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022384
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000274
Family Proline iminopeptidase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022384   Gene: ENSMMUG00000017009   Transcript: ENSMMUT00000023913
Sequence length 161
Comment pep:novel chromosome:MMUL_1:4:27013038:27016280:1 gene:ENSMMUG00000017009 transcript:ENSMMUT00000023913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTGHPAALAPAWGALVISLEHRFYGLSIPAGGLEMAQLRFLSSRHALADVVSARLALSR
LFNISSSSPWICFGGSYAGSLAAWARLKFPHLIFASVASSAPVRAVLDFSEYNDIVLHSL
GQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGF
Download sequence
Identical sequences ENSMMUP00000022384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]