SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022401 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022401
Domain Number 1 Region: 1974-2113
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-32
Family Ankyrin repeat 0.000000915
Further Details:      
 
Domain Number 2 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000151
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 410-532
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 971-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 528-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 288-456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 10 Region: 791-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000615
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 1146-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000458
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 566-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000529
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 15 Region: 219-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000719
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 16 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 17 Region: 257-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000259
Family EGF-type module 0.02
Further Details:      
 
Domain Number 18 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000675
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000675
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000116
Family Notch domain 0.0052
Further Details:      
 
Domain Number 21 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 1390-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.02
Further Details:      
 
Domain Number 23 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.00017
Further Details:      
 
Domain Number 24 Region: 1114-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.022
Further Details:      
 
Domain Number 25 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000765
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022401
Domain Number - Region: 1529-1560
Classification Level Classification E-value
Superfamily Notch domain 0.000131
Family Notch domain 0.0056
Further Details:      
 
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0034
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022401   Gene: ENSMMUG00000017022   Transcript: ENSMMUT00000023931
Sequence length 2537
Comment pep:known chromosome:MMUL_1:15:1748395:1800299:1 gene:ENSMMUG00000017022 transcript:ENSMMUT00000023931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRGGMADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQNPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGMHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCQDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRESEDYESFSCVCPTGWQGQTCEVDINECVVSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVAQLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPQIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCKPLYDQYCKDHFSDGHCDQGCSAECEWDGLDC
AEHVPERLAAGTLVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGR
EEELRKHPIKRAAEGWAAPEALLGQVKASLLPGGGGGGRRRRELDPMDVRGSIVYLEIDN
RQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAA
AFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASD
GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTP
PQGEVDADCMDVNVRGPASTGPLQSASCDGRGRGSDGHSPGELPQSFSFHDFLAQVTRHH
PAEINGSPVVFHLARLCRSQEGLCVAKAVGPPVQAFVLGRRHQCTSAQHPPEPLPVAQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGSRLAFEAGPPRLSHLPVAS
GTSTVLGCSSGGAMNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPP
NIQQQPNLQPPPSFLGGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAA
QFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSS
PPTSMQSQIARIPEAFK
Download sequence
Identical sequences 9544.ENSMMUP00000022401 ENSMMUP00000012104 ENSMMUP00000022401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]