SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022430 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022430
Domain Number 1 Region: 42-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.85e-78
Family T-box 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022430   Gene: ENSMMUG00000017047   Transcript: ENSMMUT00000023964
Sequence length 436
Comment pep:known chromosome:MMUL_1:4:163077184:163088245:-1 gene:ENSMMUG00000017047 transcript:ENSMMUT00000023964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEETGDSQQPG
YSQLGGWLLPGTSTLCPPTNPHPQFGGALSLPSTHGCDRYPALRSHRSSPYPSPYAHRNN
SPTCSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVT
PGSQAAAMSNGLGAQFFRGSPAHYAPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAA
QGRLIASWTPVSPPSM
Download sequence
Identical sequences F7HNS0 G7P486
ENSMMUP00000022430 9544.ENSMMUP00000022430 XP_014993147.1.72884 ENSMMUP00000022430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]