SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022436 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022436
Domain Number 1 Region: 49-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000224
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022436   Gene: ENSMMUG00000017050   Transcript: ENSMMUT00000023970
Sequence length 175
Comment pep:known_by_projection chromosome:MMUL_1:3:109309579:109322010:1 gene:ENSMMUG00000017050 transcript:ENSMMUT00000023970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKISVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP
DGQYVPRILFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Download sequence
Identical sequences A0A2K5V9R7 A0A2K6DFP7 F7HNR1
ENSMMUP00000022436 NP_001181233.1.72884 XP_005550106.1.63531 XP_005550107.1.63531 XP_011729362.1.29376 XP_011729364.1.29376 XP_014989393.1.72884 9544.ENSMMUP00000022436 ENSMMUP00000022436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]