SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022546 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022546
Domain Number 1 Region: 43-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.35e-56
Family T-box 0.00000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022546   Gene: ENSMMUG00000017140   Transcript: ENSMMUT00000024096
Sequence length 326
Comment pep:known_by_projection chromosome:MMUL_1:10:63809018:63827606:1 gene:ENSMMUG00000017140 transcript:ENSMMUT00000024096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAYPFAPAAGAATSAAAEPEGPGASCAAAAKAPVKKNAKVAGVSVQLEMKALWDEFNQLG
TEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRDLGGHPGKWQVSACSL
PPSPGNSGWGPARPMLGWVEQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDP
RKDSEKYAEENFKTFVFEETRFTAVTAYQNHRRAQGQVAKGPFPRGFSPRKPLEGQRQEH
PGAWLMWPVFQRLRAPGKSHQLPSGRWTGSAVARKKKKKAETSRNAPERAVELLRDAGGC
VNLGLPCPAECQPFNTQGLVAGRTPG
Download sequence
Identical sequences ENSMMUP00000022546 9544.ENSMMUP00000022546 ENSMMUP00000022546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]