SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022574 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022574
Domain Number 1 Region: 792-992
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-42
Family Laminin G-like module 0.00038
Further Details:      
 
Domain Number 2 Region: 363-567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-40
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 586-793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 36-233
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-36
Family Fibronectin type III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022574   Gene: ENSMMUG00000017163   Transcript: ENSMMUT00000024127
Sequence length 1017
Comment pep:known chromosome:MMUL_1:6:38097741:38297946:1 gene:ENSMMUG00000017163 transcript:ENSMMUT00000024127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLILGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGAPLDIKLGALNCTAFSIQWKMPRH
PGSTILGYTVFYSEVGADKSLQEQSHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQA
GKGRLSSPRHVTTLSEDSCLPPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEF
IRPDFDKRWTLIHERIQMDSMVIRGLDPDTNYQFAVRAMNSHGPSPRSWPSDIIRTLCPE
EAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPLPATKGGNKKFLVESKKMSIS
NPKTISRLVPPTSASLPVTTVAPQPIPIERKGKNGVAIMSRLFDMPCDETLCSADSFCVN
DYTWGGSRCQCNLGKGGESCSEDIIIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAE
DGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDG
QNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAV
NGRRIDMRPWPLGKALSGADVGECSSGICDEASCVNGGTCTAIKADSYICLCPLGFKGRH
CEDAFILTIPQFRESLRSYAATPWPLEPQHYLSFTEFEITFRPDSGDGVLLYSYDTGSKD
FLSINMAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNGILQVDKQKVVEGM
AEGGFTQIKCNTDIFVGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVN
VENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIVEAIEIPQF
IGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGA
LVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNI
NGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHIALVEDAADGKNINTCGAK
Download sequence
Identical sequences F7GZ28
ENSMMUP00000009691 9544.ENSMMUP00000022574 ENSMMUP00000022574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]