SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022575 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022575
Domain Number 1 Region: 565-757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-44
Family Laminin G-like module 0.00038
Further Details:      
 
Domain Number 2 Region: 136-340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-40
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 359-566
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-38
Family Laminin G-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022575   Gene: ENSMMUG00000017163   Transcript: ENSMMUT00000024128
Sequence length 782
Comment pep:known chromosome:MMUL_1:6:38236431:38297946:1 gene:ENSMMUG00000017163 transcript:ENSMMUT00000024128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVALENVHPGPEEAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPLPATKGGN
KKFLVESKKMSISNPKTISRLVPPTSASLPVTTVAPQPIPIERKGKNGVAIMSRLFDMPC
DETLCSADSFCVNDYTWGGSRCQCNLGKGGESCSEDIIIQYPQFFGHSYVTFEPLKNSYQ
AFQITLEFRAEAEDGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIK
LGGWHTVMLYRDGQNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGT
NRGFQGCVQSLAVNGRRIDMRPWPLGKALSGADVGECSSGICDEASCVNGGTCTAIKADS
YICLCPLGFKGRHCEDAFILTIPQFRESLRSYAATPWPLEPQHYLSFTEFEITFRPDSGD
GVLLYSYDTGSKDFLSINMAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNG
ILQVDKQKVVEGMAEGGFTQIKCNTDIFVGGVPNYDDVKKNSGVLKPFSGSIQKIILNDR
TIHVKHDFTSGVNVENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKAIVEAI
EIPQFIGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLG
LRDGALVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMM
RQLNINGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHIALVEDAADGKNINTCG
AK
Download sequence
Identical sequences ENSMMUP00000022575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]