SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022653 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022653
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022653   Gene: ENSMMUG00000017223   Transcript: ENSMMUT00000024209
Sequence length 701
Comment pep:known_by_projection chromosome:MMUL_1:1:2970122:2975235:1 gene:ENSMMUG00000017223 transcript:ENSMMUT00000024209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDECPEPLQQDRGPVLVRRQRPAPQGLCEMLKARLWRSCSCSVLCARALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQEGLQPGANSSILNSSAAMLDCGRDCYAIRI
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRSAGQANVCDVVTSTVCLVVLLAAKELSDRYRRRLRVPLPTELLVIV
VATLVSHFGQLHRRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVGAAFSISLA
EMFARNHGYSVCANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRATLLARIGNSAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLRSLYSLTGLDAGCVAARRKEQGSEWEVGDGGPAQGKDLGAVSSRA
VLAPAAAGFHTVVIDCAPLLFLDAAGVTTLQDLRRDYGALGISLLLACCSPPVRDALSRG
GFLGEGPGDVAEEEQLFLSVHNAVQTARARHRELEATDAHP
Download sequence
Identical sequences F7HE34
9544.ENSMMUP00000022653 XP_014993290.1.72884 ENSMMUP00000022653 ENSMMUP00000022653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]