SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022726
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 3.38e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022726   Gene: ENSMMUG00000017275   Transcript: ENSMMUT00000024283
Sequence length 390
Comment pep:known_by_projection chromosome:MMUL_1:14:7063276:7070051:-1 gene:ENSMMUG00000017275 transcript:ENSMMUT00000024283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPALCPHMLRAPARVLGEAVLPFPPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSIPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQHPESPGLHSEEDEAEPSTVPGTPPPKKF
RSLFFGSILAPVRSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences F7GWR5
XP_014969073.1.72884 ENSMMUP00000022726 9544.ENSMMUP00000022726 ENSMMUP00000022726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]