SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022847 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022847
Domain Number 1 Region: 516-635
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-26
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 2 Region: 330-455
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000034
Family FAS1 domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022847
Domain Number - Region: 196-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000813
Family Merozoite surface protein 1 (MSP-1) 0.039
Further Details:      
 
Domain Number - Region: 228-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00536
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022847   Gene: ENSMMUG00000017351   Transcript: ENSMMUT00000024411
Sequence length 791
Comment pep:known chromosome:MMUL_1:2:83865970:83880084:-1 gene:ENSMMUG00000017351 transcript:ENSMMUT00000024411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQGLLPLCLLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGMCNRGPRGDGSCL
CFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCKCLPGYTQQGSECRAPNPCWPSPCS
PLALCSVSPKGQAQCHCSENYHGDGIVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRKWWTLAGQEITVTFNQFTVREKPQPGNKRSHSRPGVVAHAC
NPSTLGRPRWADHKGPGRTQRWRLAMQPPASLAPPQNCGLPSILDGPGPFTVFAPSNEAV
DSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQVLAVNISEEG
RILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIVAGSCVDCQA
LNTSMCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCKGFFGPDCTQ
CPGGFSNPCYGKGNVSPVLSWGEVWGRQGLLHRLASDWLCVWAKPATLLGSSHPGNGKLD
QIISRILIKNN
Download sequence
Identical sequences ENSMMUP00000022847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]